DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Mycs

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_068609.2 Gene:Mycs / 24581 RGDID:3133 Length:430 Species:Rattus norvegicus


Alignment Length:122 Identity:31/122 - (25%)
Similarity:51/122 - (41%) Gaps:28/122 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ENLLDSSTNPMGVHN---SGGGAPLMCNSPSASSSGGGCGN----AGSATPG-GAGGPNPGYGSV 137
            :.|..||:||:.:.:   ||..:.....:..:....||||:    ||:..|| .|...:.|:...
  Rat   102 KGLSGSSSNPVVLQDCMWSGFSSREKPETVVSEKLPGGCGSLAVGAGTLVPGAAAAASSAGHARS 166

  Fly   138 GAATASSYKMQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLS 194
            |.|...    :|:||.:.|...:.       ::| ::||.        .||..||.|
  Rat   167 GTAGVG----RRKAAWLTELSHLD-------SEC-VDSAV--------IFPANKRES 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 12/47 (26%)
MycsNP_068609.2 Myc_N 10..331 CDD:395839 31/122 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..326
bHLHzip_N-Myc_like 344..430 CDD:381462
Leucine-zipper 399..420
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.