DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Tal1

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_006502972.1 Gene:Tal1 / 21349 MGIID:98480 Length:335 Species:Mus musculus


Alignment Length:223 Identity:58/223 - (26%)
Similarity:78/223 - (34%) Gaps:86/223 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GGATGGGGGSGGGGGS-------------SGLRLSSNNLRHIQQHYMQHSGENLLDSSTNPMGVH 94
            |..:|.|||...|||:             :.||:.:..|                   ..|.|  
Mouse    61 GARSGAGGGPASGGGAARDLKGRDAVAAEARLRVPTTEL-------------------CRPPG-- 104

  Fly    95 NSGGGAPLMCNSPSASSSGGG----CGNAGSATPGGAGG----------PNPGYGSVGAATA--- 142
              ...||...::| |...|.|    ......|.|.|.|.          .:.|.|..|...|   
Mouse   105 --PAPAPAPASAP-AELPGDGRMVQLSPPALAAPAGPGRALLYSLSQPLASLGSGFFGEPDAFPM 166

  Fly   143 -----------SSYKMQ-----------RQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVP 185
                       |.|:|:           |...|.|||.|.|          ::|.||.|||..:|
Mouse   167 FTNNNRVKRRPSPYEMEISDGPHTKVVRRIFTNSRERWRQQ----------NVNGAFAELRKLIP 221

  Fly   186 TFPYEKRLSKIDTLRLAIAYISLLREVL 213
            |.|.:|:|||.:.||||:.||:.|.::|
Mouse   222 THPPDKKLSKNEILRLAMKYINFLAKLL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 26/72 (36%)
Tal1XP_006502972.1 bHLH_TS_TAL1 191..255 CDD:381549 28/69 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.