DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Ptf1a

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_061279.2 Gene:Ptf1a / 19213 MGIID:1328312 Length:324 Species:Mus musculus


Alignment Length:130 Identity:61/130 - (46%)
Similarity:74/130 - (56%) Gaps:25/130 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GAPLMC--NSPSASSSGGGCGNAGSATPGG-AGGPNPGYGSVGAATA-------SSYKMQ--RQA 151
            ||||..  .||.:..|......|...:||. .||.|   |:..||.|       |..::|  |||
Mouse   103 GAPLAAFPYSPGSPPSCLAYPCAAVLSPGARLGGLN---GAAAAAAARRRRRVRSEAELQQLRQA 164

  Fly   152 ANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTD 216
            ||||||:|:|          |||.||:.||.|:||.||||||||:|||||||.||:.|.|::|.|
Mouse   165 ANVRERRRMQ----------SINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQAD 219

  Fly   217  216
            Mouse   220  219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 39/63 (62%)
Ptf1aNP_061279.2 HLH 162..217 CDD:238036 40/64 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.