DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and hlh-13

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_508725.1 Gene:hlh-13 / 185980 WormBaseID:WBGene00001957 Length:147 Species:Caenorhabditis elegans


Alignment Length:165 Identity:77/165 - (46%)
Similarity:96/165 - (58%) Gaps:34/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SASSSGGGCGNAGSATPGGAGGPNPGYGSVGAA--TASSYKM-------QRQAANVRERKRIQRS 163
            :||||  |||       |......|.|.|:...  ..|||..       :||.|::|||||:   
 Worm     2 TASSS--GCG-------GLPVSQCPSYSSLSKLFFMDSSYDSYYCEEPEERQTASIRERKRM--- 54

  Fly   164 APTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTDYDPLTYVEKCLR 228
                   ||||.||.|||.::|||||||||||||||.||||||::|.:||:|..|...|::||:.
 Worm    55 -------CSINVAFIELRNYIPTFPYEKRLSKIDTLNLAIAYINMLDDVLRTPEDSGQYIQKCVH 112

  Fly   229 ----GEIKADRANWNTSDLTARLSWINWENLGVHP 259
                |:|.|..  |:||||.|||:||.|..||:.|
 Worm   113 MARTGQIGAPA--WSTSDLLARLNWIKWRRLGIEP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 38/61 (62%)
hlh-13NP_508725.1 HLH 43..93 CDD:278439 38/59 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158938
Domainoid 1 1.000 49 1.000 Domainoid score I7939
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15337
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010640
OrthoInspector 1 1.000 - - oto19929
orthoMCL 1 0.900 - - OOG6_112305
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 1 1.000 - - X3328
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.