Sequence 1: | NP_001287359.1 | Gene: | Fer2 / 41961 | FlyBaseID: | FBgn0038402 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032614.2 | Gene: | Mesp1 / 17292 | MGIID: | 107785 | Length: | 243 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 55/196 - (28%) |
---|---|---|---|
Similarity: | 77/196 - (39%) | Gaps: | 40/196 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 PMGVHNSGGGAPLMCNSP----SASSSGGGCGNAG--SATPG--GAGGPNPGYGSVGAATASSYK 146
Fly 147 MQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVP--TFPYEKRLSKIDTLRLAIAYISLL 209
Fly 210 REVLQTDYDPLTYVEKCL--RG-EIKADRANWNTSDLTARL-----SWINWENLGVHPGRRTLLT 266
Fly 267 S 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fer2 | NP_001287359.1 | HLH | 148..210 | CDD:278439 | 24/63 (38%) |
Mesp1 | NP_032614.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..86 | 20/74 (27%) | |
HLH | 77..130 | CDD:278439 | 24/62 (39%) | ||
CPLCP | 153..157 | 0/3 (0%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..228 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |