DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Mesp1

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus


Alignment Length:196 Identity:55/196 - (28%)
Similarity:77/196 - (39%) Gaps:40/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PMGVHNSGGGAPLMCNSP----SASSSGGGCGNAG--SATPG--GAGGPNPGYGSVGAATASSYK 146
            ||....:...:|...:.|    .|||....|....  :.|||  |..|...|.|           
Mouse    23 PMPSDGNSVCSPAWSSDPWDGAQASSPAPPCARPARRAGTPGRRGTHGSRLGSG----------- 76

  Fly   147 MQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVP--TFPYEKRLSKIDTLRLAIAYISLL 209
             |||:|:.||:.|::          ::..|..|||..:|  ..|..:.|:||:||||||.||..|
Mouse    77 -QRQSASEREKLRMR----------TLARALHELRRFLPPSVAPTGQNLTKIETLRLAIRYIGHL 130

  Fly   210 REVLQTDYDPLTYVEKCL--RG-EIKADRANWNTSDLTARL-----SWINWENLGVHPGRRTLLT 266
            ..||....|.|......:  || .:..|.....:..|..||     |.::|.:...:|..|....
Mouse   131 SAVLGLSEDNLRRQRHAVSPRGCPLCPDSDLAQSQSLGPRLSPAVCSGVSWGSPPAYPRPRVAAE 195

  Fly   267 S 267
            |
Mouse   196 S 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 24/63 (38%)
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 20/74 (27%)
HLH 77..130 CDD:278439 24/62 (39%)
CPLCP 153..157 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.