powered by:
Protein Alignment Fer2 and Id3
DIOPT Version :9
Sequence 1: | NP_001287359.1 |
Gene: | Fer2 / 41961 |
FlyBaseID: | FBgn0038402 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_032347.1 |
Gene: | Id3 / 15903 |
MGIID: | 96398 |
Length: | 119 |
Species: | Mus musculus |
Alignment Length: | 41 |
Identity: | 15/41 - (36%) |
Similarity: | 23/41 - (56%) |
Gaps: | 0/41 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 173 INSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVL 213
:|..:..||..||..|...:||:::.|:..|.||..|:.||
Mouse 44 MNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVL 84
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.