DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Hand1

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_032239.1 Gene:Hand1 / 15110 MGIID:103577 Length:216 Species:Mus musculus


Alignment Length:182 Identity:54/182 - (29%)
Similarity:76/182 - (41%) Gaps:47/182 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NLLDSSTNPMGVHNSGGGAPLMCNSPSASSSGGGC------------GNAGSATPGGAGGPNP-- 132
            ||:.|..:....|:|....| |.:.|........|            ..|.:|....||||.|  
Mouse     2 NLVGSYAHHHHHHHSHPPHP-MLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPTT 65

  Fly   133 -----GYG-------SVGAATASSYKMQRQAAN--VRERKRIQRSAPTGYTKCSINSAFDELRVH 183
                 .||       |.|...|...::.::..:  .:||:|.:          ||||||.|||..
Mouse    66 AVAAAAYGPDARPSQSPGRLEALGSRLPKRKGSGPKKERRRTE----------SINSAFAELREC 120

  Fly   184 VPTFPYEKRLSKIDTLRLAIAYISLLREVLQTDY---DPLTYVEKCLRGEIK 232
            :|..|.:.:||||.|||||.:||:.|.:||..|.   ||     :..:.|:|
Mouse   121 IPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQAGDP-----EAFKAELK 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 25/63 (40%)
Hand1NP_032239.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 5/17 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 14/65 (22%)
HLH 103..152 CDD:197674 28/58 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.