DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and AgaP_AGAP001740

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_321346.4 Gene:AgaP_AGAP001740 / 1281435 VectorBaseID:AGAP001740 Length:206 Species:Anopheles gambiae


Alignment Length:234 Identity:64/234 - (27%)
Similarity:96/234 - (41%) Gaps:80/234 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HNFDDDLINDLPSCIYAGQHQGGGATGG-----------GGGSG----GGGGSSGLRLSSNNLRH 70
            |:|        ||  |.||..|.|:.|.           .|.||    .|..:......:::...
Mosquito    11 HSF--------PS--YYGQQFGLGSAGSAFEQNRLDSYYNGYSGYPAPSGNSAESFEPVTSSDSF 65

  Fly    71 IQQHYM-------QHSGE------------NLLDSSTNPMGVHNSGGGAPLMCNSPSASSSGGGC 116
            :||..:       ..||:            .||.|.|:...:.:|       |:| |:||:|..|
Mosquito    66 LQQQELFSICTDTSSSGKESPLALADPQSLQLLQSLTSDDSIGSS-------CSS-SSSSAGSEC 122

  Fly   117 -------GNAGSATPGGAGGPNPGYGSVGAATASSYKMQRQAANVRERKRIQRSAPTGYTKCSIN 174
                   ..|.|.:..|:|.|           ....|.:|.|||.|||||::          .:|
Mosquito   123 DIPVTVAAPAKSKSKRGSGVP-----------TVVRKKRRLAANARERKRMK----------GLN 166

  Fly   175 SAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVL 213
            .|||.||.::|:...:::|||.:||::|.:|||.|.|:|
Mosquito   167 EAFDRLRQYLPSLGNDRQLSKHETLQMAQSYISALAELL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 25/61 (41%)
AgaP_AGAP001740XP_321346.4 HLH 147..205 CDD:238036 28/67 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.