DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and AgaP_AGAP009983

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_319121.4 Gene:AgaP_AGAP009983 / 1279405 VectorBaseID:AGAP009983 Length:380 Species:Anopheles gambiae


Alignment Length:270 Identity:67/270 - (24%)
Similarity:97/270 - (35%) Gaps:102/270 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RNQLPDSSSSP----------------------PISH-----LPFHNFDDDLIND---------- 30
            |..|..||.:|                      ||||     .||.|..|.|:..          
Mosquito   126 RKHLDTSSPAPSCRTASSPFRPWAPSAMTLEGGPISHPVPFASPFPNPADLLVRHPAVTTLHRAV 190

  Fly    31 --------LPSCIYAGQHQGGGATGGGGGSGGGGGSSGLRLSSNNLRHIQQHYMQHSGENLLDSS 87
                    .|..:.|.:               ...||....||:|    |..::.||        
Mosquito   191 SIKPLEQLQPLALVAKK---------------SSASSSSSTSSSN----QHAHLHHS-------- 228

  Fly    88 TNPMGVHNSGGGAPLMCNSPSASSSGGGCGNA-----GSATPGGAGGPNPGYGSVGAATAS-SYK 146
                  |.|.|  ||.. .|.|..|..|..::     .:...||.||.:.. ||.||.:.: :||
Mosquito   229 ------HASSG--PLFV-QPRAPPSLDGTNDSITDHESTVASGGHGGKSSS-GSGGAISQTRNYK 283

  Fly   147 -MQRQ---AANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYIS 207
             |.|:   .||.|||.|:.          :|::|:::||..:|.:...::|||:..||:|.:||.
Mosquito   284 NMTRERRIEANARERTRVH----------TISAAYEKLRRAIPAYSNAQKLSKLSILRIACSYIL 338

  Fly   208 LLREVLQTDY 217
            .|..:...||
Mosquito   339 TLSRMAGEDY 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 20/64 (31%)
AgaP_AGAP009983XP_319121.4 HLH 289..340 CDD:278439 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.