DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and AgaP_AGAP000876

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_316851.3 Gene:AgaP_AGAP000876 / 1277392 VectorBaseID:AGAP000876 Length:371 Species:Anopheles gambiae


Alignment Length:242 Identity:57/242 - (23%)
Similarity:94/242 - (38%) Gaps:75/242 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GSSGLRLSSNNLRHIQQHYMQHSGENLLDSSTNPMGVHNSGGGAPLMCNSPSASSSGGGCGNAGS 121
            |:.||.|....:         .||:....|:.:.:|.......||.:.....|::...|.|...|
Mosquito    20 GNCGLALQQKPI---------GSGQLTSSSAASLLGKQRPLAPAPTVLGGHRANAKLPGAGPIVS 75

  Fly   122 ATPGGAGGPNPGYGSVG---AATASSYKMQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVH 183
            :: .|:|..:..|...|   |....|..:||:  |.|||.|:::          :|:.|..||.|
Mosquito    76 SS-SGSGNSSKKYAYCGLPYATPQQSASVQRR--NARERNRVKQ----------VNNGFANLRQH 127

  Fly   184 VPTFPY----------EKRLSKIDTLRLAIAYISLLREVLQTDYDPLTYVEKCLRGEIKADRANW 238
            :|:...          .|:|||:||||||:.||..|:.:|..:           .||:.:::   
Mosquito   128 IPSTVVTALTNGARGANKKLSKVDTLRLAVEYIRSLQRMLDEN-----------GGELPSNK--- 178

  Fly   239 NTSDLTARLSWINWENLGVHPGRRTLLTSLA----LSSEPMCGAHCG 281
                                  ::..|||.:    ||:..:|.|..|
Mosquito   179 ----------------------QQQQLTSASSTNQLSNSSLCSASSG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 25/71 (35%)
AgaP_AGAP000876XP_316851.3 HLH 107..169 CDD:197674 25/71 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.