DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Ptf1a

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_446416.1 Gene:Ptf1a / 117034 RGDID:621709 Length:326 Species:Rattus norvegicus


Alignment Length:182 Identity:67/182 - (36%)
Similarity:83/182 - (45%) Gaps:46/182 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LRHIQQHYMQHSGENLLDSSTNPMGVHNSGGGAPLMCNSP-SASSSGGGCGNAGS---ATPGGAG 128
            |.|....|....|..||.........|   ..||.....| ....||..|.:||:   |.|...|
  Rat    53 LSHQLHEYCYRDGACLLLQPAPSAAPH---ALAPPPLGDPGEPEDSGSYCCDAGAPLGAFPYSPG 114

  Fly   129 GP------------NPG------YGSVGAATASSYKMQ-----------RQAANVRERKRIQRSA 164
            .|            :||      .|:..||.|::.:.:           |||||||||:|:|   
  Rat   115 SPPSCLAYPCTAVLSPGTRLRGLNGAAAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQ--- 176

  Fly   165 PTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTD 216
                   |||.||:.||.|:||.||||||||:|||||||.||:.|.|::|.|
  Rat   177 -------SINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQAD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 38/72 (53%)
Ptf1aNP_446416.1 bHLH_TS_PTF1A 164..218 CDD:381423 40/63 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..249
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.