powered by:
Protein Alignment Fer2 and Ferd3l
DIOPT Version :9
Sequence 1: | NP_001287359.1 |
Gene: | Fer2 / 41961 |
FlyBaseID: | FBgn0038402 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_277057.1 |
Gene: | Ferd3l / 114712 |
MGIID: | 2150010 |
Length: | 168 |
Species: | Mus musculus |
Alignment Length: | 68 |
Identity: | 40/68 - (58%) |
Similarity: | 50/68 - (73%) |
Gaps: | 10/68 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 QRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREV 212
||||||:|||||: .::|.|||:||..||||.||||||:|:||||||.|||.:.|:
Mouse 104 QRQAANIRERKRM----------FNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTEL 158
Fly 213 LQT 215
||:
Mouse 159 LQS 161
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2562 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3328 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.840 |
|
Return to query results.
Submit another query.