DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Ferd3l

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_277057.1 Gene:Ferd3l / 114712 MGIID:2150010 Length:168 Species:Mus musculus


Alignment Length:68 Identity:40/68 - (58%)
Similarity:50/68 - (73%) Gaps:10/68 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREV 212
            ||||||:|||||:          .::|.|||:||..||||.||||||:|:||||||.|||.:.|:
Mouse   104 QRQAANIRERKRM----------FNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTEL 158

  Fly   213 LQT 215
            ||:
Mouse   159 LQS 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 37/61 (61%)
Ferd3lNP_277057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..88
bHLH domain 104..159 38/64 (59%)
HLH 104..156 CDD:278439 37/61 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 1 1.000 - - X3328
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.