DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and atoh8

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_002937330.2 Gene:atoh8 / 100490889 XenbaseID:XB-GENE-877027 Length:246 Species:Xenopus tropicalis


Alignment Length:226 Identity:63/226 - (27%)
Similarity:92/226 - (40%) Gaps:52/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NFDDDL-INDLPSCIYAGQHQG--GGATG----GGG-----GSGGGGGSSGLRLSSNNLRHIQQH 74
            :|..|| :::.|:....||.|.  ||..|    ||.     .:|...|..|| :.|..|...||.
 Frog    41 SFKVDLKVDEAPAEGRTGQQQELLGGRAGERVLGGDVLDLRNNGLYPGKKGL-MKSRELEGQQQP 104

  Fly    75 YMQHSGENLLDSSTNPMGVHNSGGGAPLMCNSPSASSSGGGCGNAGSATPGGAGGPNPGYGSVGA 139
            .|.     :..:...|...:.....||.   ||..           ||:|....|...|   |.:
 Frog   105 RMV-----ICPARPPPETPYLPAPQAPY---SPDP-----------SASPRNRLGETAG---VNS 147

  Fly   140 ATASSYKMQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIA 204
            ...:..:.:|..||.|||.|:.          :|::||:.||..||.:.|.::|||:..||:|..
 Frog   148 EIKAIQQTRRLLANARERTRVH----------TISAAFEALRKQVPCYSYGQKLSKLAILRIACN 202

  Fly   205 YISLLREVLQTDY----DPLTY---VEKCLR 228
            ||..|..:...||    ..|::   ||:|.|
 Frog   203 YILSLARLADLDYSVDHSNLSFPECVEQCTR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 23/61 (38%)
atoh8XP_002937330.2 bHLH_TS_ATOH8 149..216 CDD:381427 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.