DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and neurog3

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_002935814.2 Gene:neurog3 / 100038294 XenbaseID:XB-GENE-876279 Length:226 Species:Xenopus tropicalis


Alignment Length:112 Identity:39/112 - (34%)
Similarity:57/112 - (50%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREV 212
            :|..||.|||.|:.          ::|||.|.||..:||||.:.:|:||:|||.|..||..|.|.
 Frog    87 RRVKANDRERNRMH----------NLNSALDALRSVLPTFPDDAKLTKIETLRFAHNYIWALSET 141

  Fly   213 LQ-TDYDPLTYVEKCLRGEIKADRANWNTSDL---TARLSWINWENL 255
            |: .|...|:..::.|...:|....:....||   |:..|...|::|
 Frog   142 LRMADQSLLSPEQQHLLDSLKKLPKSCLMMDLSSPTSSTSSTEWDSL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 26/61 (43%)
neurog3XP_002935814.2 bHLH_TS_NGN3_ATOH5 80..147 CDD:381561 29/69 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.