DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and mespab

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001252512.1 Gene:mespab / 100006128 ZFINID:ZDB-GENE-090817-2 Length:240 Species:Danio rerio


Alignment Length:204 Identity:60/204 - (29%)
Similarity:83/204 - (40%) Gaps:60/204 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 CNSPSASSS-GGGCGNAGSATPGGAGG--PNPGYGSVGAATASSYK-----------------MQ 148
            |.|.|.||| ..||    .:.|.|||.  ..|...:|....|...|                 |:
Zfish    31 CGSLSPSSSIDSGC----FSPPWGAGRQLEGPENANVDCLQAKKLKLALPVDSKRRSRSKNPGMK 91

  Fly   149 RQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVP--TFPYEKRLSKIDTLRLAIAYISLLRE 211
            ||:|:.||:.|::          .:..|...||..:|  ..|..:.|:||:||||||:|||.|.:
Zfish    92 RQSASEREKLRMR----------DLTKALHHLRSFLPPSVAPAGQTLTKIETLRLAISYISHLSD 146

  Fly   212 VLQTDYDPLTYVEKCLRGEIKADRANWNTSDLTARLSWINWENLGVHPGRRTL----------LT 266
            .|:....| .| |.|...| .:||..          |.:.:||:.: .|::.|          ||
Zfish   147 QLRQAEVP-NY-EMCCSAE-ASDRFQ----------SGLVFENVCM-DGQQGLMQDNVQYCPTLT 197

  Fly   267 SLALSSEPM 275
            |...|.|.|
Zfish   198 SFGDSREQM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 23/63 (37%)
mespabNP_001252512.1 HLH 91..144 CDD:278439 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.