DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Sgsm2

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001361617.1 Gene:Sgsm2 / 97761 MGIID:2144695 Length:1050 Species:Mus musculus


Alignment Length:285 Identity:57/285 - (20%)
Similarity:117/285 - (41%) Gaps:75/285 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PGPYRP-----------DVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFPDN 125
            |||:.|           :...:::...||               .:..|:.|:::::|.|...|.
Mouse   796 PGPHDPGQETLAPASELEAGQELAAVCAA---------------AYTIELLDTVALNLHRIDKDV 845

  Fly   126 IHFD--------MKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVEN 182
            ...|        ...:||.:|:.:|...:.|:||.||:..:...||::.|:::.::....|:::.
Mouse   846 QRCDRNYWYFTTSNLERLRDIMCSYVWEHLDMGYVQGMCDLLAPLLVILDNDQLAYSCFSHLMKR 910

  Fly   183 IVPQY--------HSHNMANLLR--DLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFA 237
            :...:        |..||.:|::  |..:| ||:         | .|....:.....:||:..|.
Mouse   911 MGQNFPSGGAMDSHFANMRSLIQILDSELF-ELM---------H-QNGDYTHFYFCYRWFLLDFK 964

  Fly   238 EVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIV--TD 300
            ..|..|.|..:|:.::|.  :.:......:|:.           .||...:|: :|:||.:  ||
Mouse   965 RELLYEDVFAVWEVIWAA--RRISSEHFVLFIA-----------LALVEAYRE-IIRDNNMDFTD 1015

  Fly   301 CHGFVEAMFSLRLKRSELESLRKVA 325
            ...|    |:.|.:|.:.:.:.::|
Mouse  1016 IIKF----FNERAERHDAQEILRIA 1036

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 44/232 (19%)
Sgsm2NP_001361617.1 RUN 42..185 CDD:367169
PH_RUTBC 256..424 CDD:275431
TBC <838..1006 CDD:214540 39/192 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.