DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and USP6NL

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006717605.1 Gene:USP6NL / 9712 HGNCID:16858 Length:856 Species:Homo sapiens


Alignment Length:325 Identity:89/325 - (27%)
Similarity:150/325 - (46%) Gaps:33/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEYGFKRGDHFDYNNYSKFMDGYLKTLTRRRMKWEAILQ-----QNTDLTQVDAKLKRYIRKGIP 72
            |.:||...:....:|.:.....:|:  ..|..||..:|:     :||:      |..|.|.||||
Human    74 DRFGFLHEEELPDHNVAVERQKHLE--IERTTKWLKMLKGWEKYKNTE------KFHRRIYKGIP 130

  Fly    73 GPYRPDVWMKISGAAAAQRRSPDLFRNLL-RTEPFDKEISDSISIDLPRTFPDNIHF----DMKK 132
            ...|.:||..:......:..:.||:..|. |......:|. .|.:|:.|||.|:|.|    .:|:
Human   131 LQLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIR-QIDLDVNRTFRDHIMFRDRYGVKQ 194

  Fly   133 QRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLL-------KHIVENIVPQYHSH 190
            |.|:::|.||:.:|.:||||||::.|..|||:.. :||.:||.|       ||.:.....|    
Human   195 QSLFHVLAAYSIYNTEVGYCQGMSQITALLLMYM-NEEDAFWALVKLFSGPKHAMHGFFVQ---- 254

  Fly   191 NMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAE 255
            ....|||......:::.:.:..:.:|:|:..:.......|||...|.:..|....|||||....|
Human   255 GFPKLLRFQEHHEKILNKFLSKLKQHLDSQEIYTSFYTMKWFFQCFLDRTPFTLNLRIWDIYIFE 319

  Fly   256 GYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSL-RLKRSELE 319
            |.:::...:.|:...||..::.. .:..|...|::|:.:|....|.....:...|: .|||::|:
Human   320 GERVLTAMSYTILKLHKKHLMKL-SMEELVEFFQETLAKDFFFEDDFVIEQLQISMTELKRAKLD 383

  Fly   320  319
            Human   384  383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 66/220 (30%)
USP6NLXP_006717605.1 TBC 125..340 CDD:214540 66/220 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.