DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and GYP5

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_015075.1 Gene:GYP5 / 855827 SGDID:S000006170 Length:894 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:67/239 - (28%)
Similarity:120/239 - (50%) Gaps:13/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RMKWEAILQQNTDLTQVDA----KLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRT 103
            ::.|....|...|...|.:    .|:.::..|||...|..:|..:  |.:..|...|::..||.|
Yeast   420 KIDWSFWTQVVNDYATVASNEPENLEAHVTNGIPPQIRGIIWQLM--ANSKSREMEDIYETLLDT 482

  Fly   104 EPFDKEISDSISIDLPRTFPDNIHFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDD 168
            |...:.   :|..||.||   ....:.|.:.||.::..|:.::.||||.||:.:||..|||..::
Yeast   483 ECLHEA---TIRRDLRRT---KFVAEDKMESLYKVIKVYSVYDPDVGYTQGMGFIAAPLLINCEN 541

  Fly   169 EEKSFWLLKHIVENI-VPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWF 232
            |.:||.||..:::|. :.:.....|..|:..|..|..|:....|::...:...|:...:.|::||
Yeast   542 EAESFGLLVGLMKNYGLRELFLPGMPGLMLMLYQFDRLLEEHSPSLYNRLIREGISSTMYATQWF 606

  Fly   233 ICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAIL 276
            :..||...|:|.||||:|.||.||.:::.:.|:.:.:.::..::
Yeast   607 LTFFAYKFPLEFVLRIFDIVFVEGIEVLLKFAVNLMLKNEETLV 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 62/209 (30%)
GYP5NP_015075.1 COG5210 154..737 CDD:227535 67/239 (28%)
SMC_prok_B 726..>891 CDD:274008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.