DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and GYL1

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_013917.1 Gene:GYL1 / 855230 SGDID:S000004804 Length:720 Species:Saccharomyces cerevisiae


Alignment Length:290 Identity:67/290 - (23%)
Similarity:123/290 - (42%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WEAIL--QQNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTE--PF 106
            |..::  .||..:..::. |...:.:|||..||..||..:|   .|:.:|.|.......||  ||
Yeast   272 WLKVIGDYQNILINDIET-LHFQLSRGIPAAYRLVVWQLVS---YAKSKSFDPIYETYLTEMAPF 332

  Fly   107 D-KEISDSISI--DLPRTFPDNIHFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDD 168
            | :|..:.:.:  ::|..:         .:|:.|:|.||...:.:..:...:.||..::|.|.::
Yeast   333 DVQEFENQLKMMDEVPSEY---------VKRISNVLKAYLLFDPECEFSTDIAYIINMILDVCEE 388

  Fly   169 EEKSFWLLKHIVE------NIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVI 227
            |..:|.||..:::      ..:|   |.:..::|  ...|..||....|.::.|:...|:...:.
Yeast   389 EANAFGLLVRLMKVYGLRLLFLP---SASEIDIL--CYKFDRLVEEFYPEIHNHMVEKGVRSSMF 448

  Fly   228 ASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAIL--GCDDI--------- 281
            ...:|..:|.:.||.|...||.|.||.||...:.|...|:....::.:|  |.||:         
Yeast   449 LPGFFTTLFQKKLPTEIQPRIGDMVFLEGIDSIMRILATLLSNSRDHLLKMGFDDMLELLKSGLL 513

  Fly   282 -------------AALANLFRDTMIQDNIV 298
                         ..|:|...|.::||:::
Yeast   514 DAYIKQNDGTRGDTLLSNECMDKLLQDSMM 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 54/219 (25%)
GYL1NP_013917.1 COG5210 27..569 CDD:227535 67/290 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.