DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and BUB2

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_013771.1 Gene:BUB2 / 855077 SGDID:S000004659 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:268 Identity:58/268 - (21%)
Similarity:107/268 - (39%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEI 110
            |..:.|     |.::|..:||:.....||....::.||....:...::...|||         .:
Yeast    47 WTVLSQ-----TSMEASTQRYLALLKLGPPSTTIYQKIKNDTSRTFQTDPNFRN---------RV 97

  Fly   111 SDSISIDLPRTFPDNIHFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWL 175
            |:...|.....|........:|.|...|.::        .|.||:|.:...||.....|..::.|
Yeast    98 SEDALIRCLSCFAWQTQQRRQKTRFGRIPVS--------TYVQGMNVLLAPLLYSCPSEPMAYQL 154

  Fly   176 LKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRI-PAVNRHV-DNL------GLPYPVIASKWF 232
            ...:...::|.|.:.|: |..::.|...::.:|.| |.:::.: |||      |:|..:..|.  
Yeast   155 FTKLCYEMIPTYLTKNL-NGAQNGAKLLDISLRIIDPKLSKFLSDNLLTAEIYGMPSILTLSS-- 216

  Fly   233 ICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNI 297
             |    ..|::.|:::||.:||.|:.:.....:...|..::.:...|....|...|.| ...|.|
Yeast   217 -C----NKPLDQVIKLWDFMFAYGFHMNILFVVAFLVKMRSKVFKSDSPVNLLRQFPD-FDADEI 275

  Fly   298 VTDCHGFV 305
            :....||:
Yeast   276 IRLGVGFI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 44/216 (20%)
BUB2NP_013771.1 COG5210 <1..304 CDD:227535 58/268 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.