DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and GYP6

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_012491.3 Gene:GYP6 / 853406 SGDID:S000003580 Length:458 Species:Saccharomyces cerevisiae


Alignment Length:326 Identity:68/326 - (20%)
Similarity:121/326 - (37%) Gaps:89/326 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TASSKFSDVDEYG------FKRGDHFDYNNYSKFMDGYLKTLT------RRRMKWEAILQQNTDL 56
            |.:.|..|::::|      ...||::|.|:.:......|.:..      ||....||:  :...|
Yeast    58 TDNFKGLDLNQFGLVPVPMLADGDNYDENHNANVPKRVLHSNVSSSVGIRRLTPVEAV--EKHPL 120

  Fly    57 TQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRT 121
            :..:.|.|..:.||                   ....|...|..|          :.|.:||.|.
Yeast   121 SDDNDKTKGSLSKG-------------------SDEKPLTLRETL----------EIIDLDLSRI 156

  Fly   122 FPDNIHFDMK-----KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIV----TD----DEEKSF 173
            ..|:|..:.|     :|.|||.|:  .|.:..:.|.||.:.|..::.:.    ||    |.:...
Yeast   157 MLDDIFQEPKVHAQMRQLLYNYLL--IHQSEHLQYKQGFHEILSVIYLQLYHGTDLDNTDLQNVL 219

  Fly   174 WLLKHIVENIVPQYHSHNMANLLR-DLAVFRELVIRRIPAV---------------NRHVDNLGL 222
            .:...::..|.|.:  :|..||:. |..||.::....:|.:               .::||:|..
Yeast   220 IIFNKLMNQIEPIF--YNEENLINWDKRVFTKIFRICLPDLFSKVFYQPPKTGSGKKKNVDHLIH 282

  Fly   223 PYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANL 287
            ...:...:|...:|...||::.||.:||.|      :.|...|.:|:       .|..|..|.::
Yeast   283 SNLIWLIRWTRLLFLRELPLKYVLIVWDHV------LTFNYPLDIFI-------ACTIITLLLSI 334

  Fly   288 F 288
            :
Yeast   335 Y 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 49/237 (21%)
GYP6NP_012491.3 TBC <145..336 CDD:214540 48/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.