DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and GYP7

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_010047.1 Gene:GYP7 / 851364 SGDID:S000002393 Length:746 Species:Saccharomyces cerevisiae


Alignment Length:290 Identity:62/290 - (21%)
Similarity:109/290 - (37%) Gaps:62/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDATASSKFSDV------DEYGFKRGDHFDYNNYSKFMDGYLKTLTRRRMKWEAILQQNTDLTQV 59
            :|.|.::::..:      |...|...|..:|.|...|.   :....||..:...|.|.||    :
Yeast   414 IDQTLAAEYDQLKLTWSKDFLQFDDEDEEEYWNDQLFR---ISKDVRRCDRNLEIFQYNT----I 471

  Fly    60 DAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFPD 124
            |         |:|.|               .::.|....|....|..:.|..|:   |.....|.
Yeast   472 D---------GLPPP---------------PQQLPANENNSTSPESANDESDDA---DDGVRNPH 509

  Fly   125 NIHFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHS 189
            .||       |.||||.|..:|.::||.||:..:...:.::..:|.|:||...|.:: |:.:...
Yeast   510 LIH-------LQNILITYNVYNTNLGYVQGMTDLLSPIYVIMKEEWKTFWCFTHFMD-IMERNFL 566

  Fly   190 HNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICI------FAEVLPVETVLRI 248
            .:.:.:...:....|||...:|.::.|::...      :...|.|.      |.....:|.::.|
Yeast   567 RDQSGIHEQMLTLVELVQLMLPELSEHLNKCD------SGNLFFCFRMLLVWFKREFEMEDIMHI 625

  Fly   249 WDCVFAEGYKIVFRAALTMFVTHKN--AIL 276
            |:..:...|...|:....:.:..||  |||
Yeast   626 WENFWTFYYSSQFQLFFMLAILQKNSQAIL 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 45/216 (21%)
GYP7NP_010047.1 COG5210 134..738 CDD:227535 62/290 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.