DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and AT3G07890

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001078123.1 Gene:AT3G07890 / 819980 AraportID:AT3G07890 Length:400 Species:Arabidopsis thaliana


Alignment Length:326 Identity:109/326 - (33%)
Similarity:176/326 - (53%) Gaps:40/326 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KFSDVDEYGFK-RGDHFDYNNYSKFMDGYLKTLTRRRMKW--EAILQQN---------------- 53
            ||.|:  |||. .|:..|.|..::..:   |...:.|:.|  ||....|                
plant    35 KFQDL--YGFTVEGNVDDVNVLNEVRE---KVRNQGRVWWALEASKGANWYLQPEILLIGDGIAL 94

  Fly    54 -TDL---TQVDA-KLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDS 113
             |.|   |..:| .|||.||||||...||.||..:||||..:...|:.:.:.| |:..:..::.:
plant    95 KTSLKLSTLTNAITLKRLIRKGIPPVLRPKVWFSLSGAAKKKSTVPESYYSDL-TKAVEGMVTPA 158

  Fly   114 ---ISIDLPRTFPDNIHFDMKK--QRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSF 173
               |..|||||||.:...|..:  ..|..:|:.|:..:.||||||||||:|.|||:|...||.:|
plant   159 TRQIDHDLPRTFPGHPWLDTPEGHAALRRVLVGYSFRDSDVGYCQGLNYVAALLLLVMKTEEDAF 223

  Fly   174 WLLKHIVENI-VPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFA 237
            |:|..::||: |...::.|::....:..||::|:.::...:..|::::|....::|::||:|:|:
plant   224 WMLAVLLENVLVRDCYTTNLSGCHVEQRVFKDLLAQKCSRIATHLEDMGFDVSLVATEWFLCLFS 288

  Fly   238 EVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQ----DNIV 298
            :.||.||.||:||.:|.||.|::|.|||.:|...:|.:|....:..:.|:.:.|..|    |.::
plant   289 KSLPSETTLRVWDVLFYEGAKVLFHAALAIFKMKENELLMTHQVGDVINILQKTSHQLFDPDELL 353

  Fly   299 T 299
            |
plant   354 T 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 81/214 (38%)
AT3G07890NP_001078123.1 TBC 113..327 CDD:214540 81/214 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1404
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1551
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 1 1.000 - - FOG0003486
OrthoInspector 1 1.000 - - oto4205
orthoMCL 1 0.900 - - OOG6_100958
Panther 1 1.100 - - LDO PTHR22957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.