DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and AT2G37290

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001189697.1 Gene:AT2G37290 / 818306 AraportID:AT2G37290 Length:916 Species:Arabidopsis thaliana


Alignment Length:319 Identity:101/319 - (31%)
Similarity:147/319 - (46%) Gaps:63/319 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLL-RTEPFDKEISD-------SISIDL 118
            :|:..:|.|:|...|.:||....|..|  ||....:::|| :....|:..||       .|..|:
plant   309 ELEVLVRLGVPKDLRGEVWQAFVGVKA--RRVERYYQDLLAQITNSDENSSDVQRKWKKQIEKDI 371

  Fly   119 PRTFPDNIHFDMK-KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVEN 182
            |||||.:...:.. :..|..||:|||.||..|||||.:|:.|||||::. .||.:||.|..|:::
plant   372 PRTFPGHPALNENGRDSLRRILLAYACHNPSVGYCQAMNFFAGLLLLLM-PEENAFWTLVGIIDD 435

  Fly   183 IVPQYHSHNMANLLRDLAVFRELVIRRIP-----------------------------------A 212
            ....|::..|.....|..||.||:..|.|                                   |
plant   436 YFDGYYTEEMIESQVDQLVFEELMRERFPKLGSLFSSDIQVSLHIFLPYTEQCDRFFYSNNPPDA 500

  Fly   213 VNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIV-FRAALTMFVTHKNAIL 276
            || |:|.||:....|:..||:.||..::|.|.|||:||.:..||.::| ||.|..:...:..||:
plant   501 VN-HLDYLGVQVAWISGPWFLSIFVNIIPWECVLRMWDVLLFEGNRVVLFRTAFAIMELYGPAIV 564

  Fly   277 GCDD----IAALANLFRDTMIQDNIV-TDCHGFVEAMFSLRLKRSELESLRKV---AVL 327
            ...|    |.:|.:|...|.....:| |.|.|::..      ..:.||.|||:   |||
plant   565 ATKDAGDAITSLQSLASSTFDSSQLVLTACMGYIST------NEARLEELRKIHRPAVL 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 82/253 (32%)
AT2G37290NP_001189697.1 RabGAP-TBC 363..563 CDD:278964 66/201 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.