DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D17

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_078958.2 Gene:TBC1D17 / 79735 HGNCID:25699 Length:648 Species:Homo sapiens


Alignment Length:274 Identity:60/274 - (21%)
Similarity:116/274 - (42%) Gaps:62/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KFMDGYLKTLTRRRMKWEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDV-WMKISGAAAAQRRS 93
            ||:.|||        .||...:::          |.:|||.....:|..: |..:|  ...:||:
Human   321 KFLLGYL--------SWEGTAEEH----------KAHIRKKTDEYFRMKLQWKSVS--PEQERRN 365

  Fly    94 PDL--FRNLLRTEPFDKEISDSISIDLPRTF---PDNIHFDMKKQRLYNILIAYAHHNRDVGYCQ 153
            ..|  :|:|:     ::::|.:   |....|   |:|....:    |.:||:.|..::.|:||.|
Human   366 SLLHGYRSLI-----ERDVSRT---DRTNKFYEGPENPGLGL----LNDILLTYCMYHFDLGYVQ 418

  Fly   154 GLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRI--PAVNRH 216
            |::.:...:|.|..:|..:||.....:| :|......:...:.|.|.  |.|::.|:  |.:...
Human   419 GMSDLLSPILYVIQNEVDAFWCFCGFME-LVQGNFEESQETMKRQLG--RLLLLLRVLDPLLCDF 480

  Fly   217 VDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFA--EGYKIVFRAALTMFVTHKNAILGCD 279
            :|:..........:|.:..|....|...|||:|:.::.  .|..:             :.::.| 
Human   481 LDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLWTGLPGPNL-------------HLLVAC- 531

  Fly   280 DIAALANLFRDTMI 293
               |:.::.|||::
Human   532 ---AILDMERDTLM 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 47/218 (22%)
TBC1D17NP_078958.2 DUF3548 5..218 CDD:192931
Required for interaction with OPTN. /evidence=ECO:0000269|PubMed:22854040 218..309
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..259
TBC 307..542 CDD:214540 60/272 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..648
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.