DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d10a

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001136376.1 Gene:tbc1d10a / 779497 XenbaseID:XB-GENE-5813721 Length:506 Species:Xenopus tropicalis


Alignment Length:311 Identity:89/311 - (28%)
Similarity:139/311 - (44%) Gaps:42/311 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEYGF-----KRGDHFDYNNYSKFMDGYLKTLTRRRMKWEAILQQNTD--LTQVDAKLKRYIRKG 70
            |.|||     .:|:..|        |..::.|.:|..||..:| .|.|  :.:...|:|...:||
 Frog    47 DRYGFLVKPESQGEPQD--------DLPVEVLRQREAKWLDML-SNWDKWMAKKHKKIKLRCQKG 102

  Fly    71 IPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFPDNIHFDMK---- 131
            ||...|...|..:||:.....:||:.|.. |.:...|.:..|.|..||.|.||.:..|..:    
 Frog   103 IPPSLRGRAWQYLSGSKVKMNQSPNKFIE-LDSMTGDPKWLDVIERDLHRQFPFHEMFVARGGHG 166

  Fly   132 KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLL 196
            :|.|:.:|.||..:..:.||||....||.:||:.. ..|::||.|..|.:..:|.|:|..:..:.
 Frog   167 QQDLFRVLKAYTLYRPEEGYCQAQAPIAAVLLMHM-PAEQAFWCLVQICDKYLPGYYSEKLEAIQ 230

  Fly   197 RDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVF 261
            .|..:...|:.:..|...:|:....:...:..::||:|.|:..||..:|||:||..|.||.||:|
 Frog   231 LDGRILFSLLRKVSPVAYKHLSKYKIDPILYMTEWFMCAFSRTLPWSSVLRVWDMFFCEGVKIIF 295

  Fly   262 RAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSLR 312
            |.||.                    |.:.|:.....:..|.|..|.|..|:
 Frog   296 RVALV--------------------LLKYTIGSSEKLKTCQGQYETMEKLK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 66/212 (31%)
tbc1d10aNP_001136376.1 TBC 101..303 CDD:214540 67/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.