DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d21

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_083130.1 Gene:Tbc1d21 / 74286 MGIID:1921536 Length:336 Species:Mus musculus


Alignment Length:307 Identity:56/307 - (18%)
Similarity:115/307 - (37%) Gaps:53/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RMKWEAILQQNTDLTQVDAKLKRYI-----RKGIPGPYRPDVWMKISGAAAAQ------------ 90
            :.:|::...:|..|    ||.:.:|     .:|:....|.:.|..::|..:.|            
Mouse    29 KAEWDSFFDENGHL----AKSRDFICINILERGLHPFVRTEAWKFLTGYYSWQSSRDERLMVDSN 89

  Fly    91 --RRSPDLFRNLLRTEPFDK-------EISDSISIDLPRTFP----DNIHFDMKKQRLYNILIAY 142
              |....|.:...:.:|..:       |..::|:.|:.|.:.    .|:..|.||.. ..:|::|
Mouse    90 RRRNYNSLCQMYEKIQPLLENLHGNFTETRNNIAYDIQRLYDKDPLGNVLIDKKKLE-KTLLLSY 153

  Fly   143 AHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMA---NLLRDLAVFRE 204
            . .|....|.:|.:.:..|..::.:.:.::|||.:..:     |...|:..   .:.::|.:...
Mouse   154 V-CNTKAEYQRGFHEMVMLFQLMVEHDHETFWLFQFFL-----QKTEHSCVINIGVGKNLDMLNS 212

  Fly   205 LVIRRIPAVNRHVDNLGLPYPVIASKWF-ICIFAEVLPVETVLRIWDCVF----AEGYKIVFRAA 264
            |:....|....|:...|.........|| :|........:.|.|:|:.:.    ...::::...:
Mouse   213 LITLLDPEFAEHLKGKGSGAVQSLFPWFCLCFQRAFKTFDDVWRLWEVLLTGKPCRNFQVLVAYS 277

  Fly   265 LTMFVTHKNAILGC---DDIAALANLFRDTMIQDNIVTDCHGFVEAM 308
            :...| .:.|:|.|   |.|....|...|....:.|...|..:.|.|
Mouse   278 MLQMV-REQALLECMSGDAILMACNNLIDLDADELISAACVVYSELM 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 41/246 (17%)
Tbc1d21NP_083130.1 TBC 62..287 CDD:214540 38/232 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.