DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d30

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_017947631.1 Gene:tbc1d30 / 734068 XenbaseID:XB-GENE-5823666 Length:942 Species:Xenopus tropicalis


Alignment Length:344 Identity:88/344 - (25%)
Similarity:156/344 - (45%) Gaps:74/344 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AILQQNTDLTQVDAKLK---------------------------RYIRKGIPGPYRPDVWMKISG 85
            |.||..:...:||.|||                           ..:..|||..:|..||:.:: 
 Frog   209 ACLQAVSQKRRVDTKLKFTLEPSLGQNGFQQFFCLQWYDALKAVARLPTGIPKEWRKRVWLTLA- 272

  Fly    86 AAAAQRRSPDLFRNLL--------------RTEPFDKEISDSISIDLPRTFPDNI---HFDMKKQ 133
                     |.:.:.:              |:.|.|..:...|..||.||...:.   ..:..:.
 Frog   273 ---------DHYLHSISIDWDKTMRFTFNDRSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRV 328

  Fly   134 RLYNILIAYAHHNRDVGYCQGLNYIAGLLL-IVTDDEEKSFWLLKHIVENIVP-QYHSHNMANLL 196
            .|..:|:|||..|:.:|||||.|.:|.|:| ::..:|..:..::.::::.::| .|.::|:..|.
 Frog   329 VLKRVLLAYARWNKTIGYCQGFNILAALILEVMEGNEGDALKVMIYLIDKVLPDSYFANNLRALS 393

  Fly   197 RDLAVFRELVIRRIPAVNRHVDNL----------GLPYP---VIASKWFICIFAEVLPVETVLRI 248
            .|:||||:||..::|.:::|:|.|          |...|   |...:||:.:||..||..|||:|
 Frog   394 VDMAVFRDLVRMKLPELSQHLDVLQRTANKESGGGYEPPLTNVFTMQWFLTLFATCLPNHTVLKI 458

  Fly   249 WDCVFAEGYKIVFRAALTMFVTHKNAILGC---DDIAALANLFRDTMIQDNIVTDCHGFVEAMFS 310
            ||.||.||.:|:.|.:|.::......|..|   ||..:........|::|::: |.:..::.::|
 Frog   459 WDSVFFEGSEILLRVSLAIWAKLGEQIECCQNSDDFYSTMGRLTQEMLEDSLI-DSNELMQTVYS 522

  Fly   311 L-RLKRSELESLRKVAVLN 328
            : :....:|..||:....|
 Frog   523 MAQFPFPQLAELREKYTYN 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 68/240 (28%)
tbc1d30XP_017947631.1 TBC 258..477 CDD:214540 68/228 (30%)
DUF4682 646..789 CDD:374060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.