DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d2b

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_012822167.2 Gene:tbc1d2b / 734055 XenbaseID:XB-GENE-5932742 Length:944 Species:Xenopus tropicalis


Alignment Length:327 Identity:96/327 - (29%)
Similarity:157/327 - (48%) Gaps:47/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKTLTRRR-------MKWEAILQQNTDLTQV-DAKLKRYIRKGIPGPYRPDVW--------MKIS 84
            ||||:...       :||:.......:.... ..:||..:|.|||..:|..:|        .|:.
 Frog   601 LKTLSLTENQEISNVVKWDNYFASTVNREMACSPELKALVRNGIPHEHRSRMWKWFTNLHIKKLK 665

  Fly    85 GAAAAQRRSPDLFRNLLRTEPFDKE--ISDSISIDLPRTFPDNIHFDMKK----QRLYNILIAYA 143
            ..||     |..|::||: ...:|:  .|..|.:||.||.|:|.|:....    |:|.|:|:||:
 Frog   666 DEAA-----PGYFQSLLQ-NALEKQNPASKQIELDLMRTLPNNKHYTSPTSEGIQKLRNVLLAYS 724

  Fly   144 HHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQ-YHSHNMANLLRDLAVFRELVI 207
            ..|.|:|||||:|.:|.:.|:..|.|: :||.|..|||..:|: |::..:.....|..||::|:.
 Frog   725 WRNPDIGYCQGINRLAAIALLYLDQED-AFWCLVTIVEAFMPRDYYTKTLLGSQVDQRVFKDLMN 788

  Fly   208 RRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHK 272
            .::|.:..|.:...:.|.:|...||:.:|.:.:..:.:.||||.:..||.|::||.||.:|...:
 Frog   789 EKLPRLCAHFEQYKVDYTLITFNWFLVVFVDSVVSDILFRIWDSLLYEGSKVIFRFALGLFKYKE 853

  Fly   273 NAILGCDDIAALANLFR-------DTMIQDNIV-TDCHGF---------VEAMFSLRLKRSELES 320
            ..||...|..::....|       |.....||. .|.:.|         ...:..:||:.||||:
 Frog   854 EEILKLQDSMSIFKYLRYFSRTILDARKLCNIAFVDMNPFPLRQIRNRRTYHLEKVRLELSELEA 918

  Fly   321 LR 322
            :|
 Frog   919 IR 920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 72/223 (32%)
tbc1d2bXP_012822167.2 PH_TBC1D2A 34..134 CDD:269966
BAR 313..>425 CDD:416402
Smc <324..532 CDD:224117
TBC 640..857 CDD:214540 72/223 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.