DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d9

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001104774.1 Gene:Tbc1d9 / 71310 MGIID:1918560 Length:1264 Species:Mus musculus


Alignment Length:287 Identity:82/287 - (28%)
Similarity:137/287 - (47%) Gaps:46/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKTLTRRR----------------MKW--------EAILQQNTDLTQVDAKLKRYIRKGIPGPYR 76
            |.|:.|||                ..|        :.|....|:      |.:..:.||||...|
Mouse   463 LMTMYRRRSPEEFNPKLAKEFLKEQAWKIHFAEYGQGICMYRTE------KTRELVLKGIPESMR 521

  Fly    77 PDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEI------SDSISIDLPRTFPDNIHF--DMKKQ 133
            .::|:.:|||...:...|..:..|:     :|.:      ::.|..||.|:.|::..|  :|...
Mouse   522 GELWLLLSGAINEKATHPGYYEGLV-----EKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIA 581

  Fly   134 RLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRD 198
            .|..:|.|||..|.::||||.:|.:..:||:...:|| :||||..:.|.::|.|::..:...|.|
Mouse   582 ALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEE-AFWLLVALCERMLPDYYNTRVVGALVD 645

  Fly   199 LAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRA 263
            ..||.||....:|.:...:.:||: ...|:..||:.:|..|:|.|:.:.:.||.|.||.|::|:.
Mouse   646 QGVFEELARDYVPQLYDCMQDLGV-ISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQL 709

  Fly   264 ALTMFVTHKNAILGC-DDIAALANLFR 289
            ||.:...:.:.:|.| ||..|:..|.|
Mouse   710 ALAVLDANVDKLLNCKDDGEAMTVLGR 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 66/216 (31%)
Tbc1d9NP_001104774.1 PH-GRAM1_TCB1D9_TCB1D9B 157..255 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 304..399 CDD:270161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 410..456
TBC 512..722 CDD:214540 66/216 (31%)
EFh <893..923 CDD:298682
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1119..1162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.