DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d13

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_666364.1 Gene:Tbc1d13 / 70296 MGIID:2385326 Length:400 Species:Mus musculus


Alignment Length:322 Identity:62/322 - (19%)
Similarity:110/322 - (34%) Gaps:111/322 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KWEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRS--PDL--------FRN 99
            :|....:.|..|.|:|..::|..         ||:       :..||.:  |.|        |..
Mouse   109 RWNTYFKDNEVLLQIDKDVRRLC---------PDI-------SFFQRATEYPCLLILDPQNEFET 157

  Fly   100 L--------LRTEPFDKEISDSISIDLP------------RTFPD--NIHFDMKKQRLYNILIAY 142
            |        |:::...:..|...::..|            ...|:  ..|:::.::    ||..|
Mouse   158 LRKRVEQTTLKSQTVARNRSGVTNMSSPHKNSAPSALNEYEVLPNGCEAHWEVVER----ILFIY 218

  Fly   143 AHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFW--------------LLKHIVENIVPQ------- 186
            |..|..:.|.||:|.|.|.|......:..|.|              |:..|.:|.:..       
Mouse   219 AKLNPGIAYVQGMNEIVGPLYYTFATDPNSEWKEHAEADTFFCFTNLMAEIRDNFIKSLDDSQCG 283

  Fly   187 --YHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIW 249
              |....:.:.|:|..|  ||.::        :....:.....|.:|...:.::...:..|:|||
Mouse   284 ITYKMEKVYSTLKDKDV--ELYLK--------LQEQSIKPQFFAFRWLTLLLSQEFLLPDVIRIW 338

  Fly   250 DCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRD-----------TMIQDNIVTD 300
            |.:||:|.:..|            .:|.|   .|:..|.|:           .::||..:||
Mouse   339 DSLFADGNRFDF------------LLLVC---CAMLILIREQLLEGDFTVNMRLLQDYPITD 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 47/263 (18%)
Tbc1d13NP_666364.1 TBC 32..367 CDD:214540 58/302 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.