DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Grtp1

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001355787.1 Gene:Grtp1 / 66790 MGIID:1914040 Length:359 Species:Mus musculus


Alignment Length:343 Identity:140/343 - (40%)
Similarity:203/343 - (59%) Gaps:27/343 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASSKFSDVDEYGFKRGDHFDYNNYSKFMDGYLKTLTRRRMKWEAILQQNTDLTQVDAKLKRYIRK 69
            |.::...:|.|||:|.:.|||..|.:|...||..||:|.:||..:|:.|..:.: ...:|||:||
Mouse    10 ARARVPRIDPYGFERPEDFDYAAYEEFFSTYLVILTKRAIKWSKLLKGNGGVRK-SVTVKRYVRK 73

  Fly    70 GIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFPDNIHF-----D 129
            |||..:|..|||.:|||.|...:||..:..||..|. ...:.::|..||.||||||:.|     .
Mouse    74 GIPLEHRARVWMAVSGAQARMDQSPGYYHRLLEGES-SSSLDEAIRTDLNRTFPDNVMFRKTADP 137

  Fly   130 MKKQRLYNILIAYAHHNRDVGYCQ-----------------GLNYIAGLLLIVTDDEEKSFWLLK 177
            ..::.|||:|:||..||.||||||                 |:|:|||.|:::|.:||:|||||.
Mouse   138 CLQKTLYNVLLAYGLHNPDVGYCQCCAQKPGSSAGLRSSLTGMNFIAGYLILITKNEEESFWLLD 202

  Fly   178 HIVENIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPV 242
            .:|..|:|.|:|..|..|..|..|..|||..::|||...:|..|:.:.::.|:||||:|.::|||
Mouse   203 ALVGRILPDYYSPAMLGLKTDQEVLAELVRMKLPAVAALMDGHGVLWTLLVSRWFICLFVDILPV 267

  Fly   243 ETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEA 307
            |||||||||:|.||.||:||.|||:...|:..||....|..:.:.|:. :.:.:.||:||.|::.
Mouse   268 ETVLRIWDCLFNEGSKIIFRVALTLIKQHQEFILEASSIPDICDKFKQ-ITKGDFVTECHAFMQK 331

  Fly   308 MFSL--RLKRSELESLRK 323
            :||.  .|..:.:..|||
Mouse   332 IFSEPGSLSMTTITRLRK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 102/230 (44%)
Grtp1NP_001355787.1 TBC 71..301 CDD:214540 102/230 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10559
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H84592
Inparanoid 1 1.050 259 1.000 Inparanoid score I3117
Isobase 1 0.950 - 0 Normalized mean entropy S2150
OMA 1 1.010 - - QHG53652
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 1 1.000 - - FOG0003486
OrthoInspector 1 1.000 - - oto93505
orthoMCL 1 0.900 - - OOG6_100958
Panther 1 1.100 - - LDO PTHR22957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 1 1.000 - - X2377
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.820

Return to query results.
Submit another query.