DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d15

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006514020.1 Gene:Tbc1d15 / 66687 MGIID:1913937 Length:688 Species:Mus musculus


Alignment Length:288 Identity:54/288 - (18%)
Similarity:108/288 - (37%) Gaps:48/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DATASSKFSDVDEYGFKRGDHFDYNNYSKFMDGYLKTLTRRR-----MKWEAILQQNTDLTQVDA 61
            ||....|.:..:|.||:.....|...         :.:.:||     .:|...|.....|..|::
Mouse   282 DAIPGLKINQQEEPGFEVITRIDLGE---------RPVVQRREPVSLEEWNKSLDPEGRLVAVES 337

  Fly    62 KLKRYIRKGIPGPYRPDVWMKISG-----------AAAAQRRSPDLFRNLLRTEPFDKEISDS-- 113
            ..::..|.|:....|...|..:.|           ....::::.:.||..|:.    |.:|::  
Mouse   338 MKQKIFRGGLSHSLRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQW----KSVSEAQE 398

  Fly   114 ------------ISIDLPRTFPDNIHFDMKKQ----RLYNILIAYAHHNRDVGYCQGLNYIAGLL 162
                        |..|:.||...|..::.:..    .|::||:.|..::.|:||.||::.:...|
Mouse   399 KRNSRLRDYRSLIEKDVNRTDRTNKFYEGQDNPGLILLHDILMTYCMYDFDLGYVQGMSDLLSPL 463

  Fly   163 LIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVI 227
            |.|.::|..:||.....::. :.|.....|..:...|.....|:.........::::....|...
Mouse   464 LYVMENEVDAFWCFASYMDQ-MHQNFEEQMQGMKTQLIQLSTLLRLLDSGFCSYLESQDSGYLYF 527

  Fly   228 ASKWFICIFAEVLPVETVLRIWDCVFAE 255
            ..:|.:..|........:||:|:.::.|
Mouse   528 CFRWLLIRFKREFSFLDILRLWEVMWTE 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 41/218 (19%)
Tbc1d15XP_006514020.1 DUF3548 10..211 CDD:371881
TBC 343..578 CDD:214540 41/218 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.