DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D14

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_011511809.1 Gene:TBC1D14 / 57533 HGNCID:29246 Length:727 Species:Homo sapiens


Alignment Length:356 Identity:78/356 - (21%)
Similarity:126/356 - (35%) Gaps:104/356 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKTLTRRRMKWE-----------AILQQNTDLTQ------VDAKLKRYIRKGIPGPYRPDVWMKI 83
            ||...||:.:.|           |:|..|.::..      ...|::....:|||...|..||...
Human   350 LKEAQRRKKQLEERCRVEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLA 414

  Fly    84 SG--------------AAAAQR-RSPDLFRNLLRTE-----PFDKEIS-DSISIDLPRTFPD--- 124
            .|              |.|.:| ||.....:.:..|     ..|:|.| :.|.:|:.||||:   
Human   415 IGNELNITHELFDICLARAKERWRSLSTGGSEVENEDAGFSAADREASLELIKLDISRTFPNLCI 479

  Fly   125 --------------NIHFDMKKQR--------------------LYNILIAYAHHNRDVGYCQGL 155
                          ...|..:|:|                    |::||.||..:..||||.||:
Human   480 FQQVLIFVDFRVGLQKSFQKRKERESTKLQQLWSWCLGGPYHDMLHSILGAYTCYRPDVGYVQGM 544

  Fly   156 NYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYH---SHNMANLLRDLAVFRELVIRRIPAVNRHV 217
            ::||.:|::..|..: :|....:::........   .|.:  :|...|.|.......:|.:..|.
Human   545 SFIAAVLILNLDTAD-AFIAFSNLLNKPCQMAFFRVDHGL--MLTYFAAFEVFFEENLPKLFAHF 606

  Fly   218 DNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIA 282
            ....|...:....|...::::.||::...||||....:|.:.:||.||                 
Human   607 KKNNLTPDIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTAL----------------- 654

  Fly   283 ALANLFRDTMIQDNIVTDCHGFVEAMFSLRL 313
            .:..||.|      |:|.......|.|..||
Human   655 GILKLFED------ILTKMDFIHMAQFLTRL 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 60/269 (22%)
TBC1D14XP_011511809.1 TBC 398..664 CDD:214540 63/291 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.