DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d30

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_021331078.1 Gene:tbc1d30 / 569334 ZFINID:ZDB-GENE-030131-2064 Length:1063 Species:Danio rerio


Alignment Length:339 Identity:87/339 - (25%)
Similarity:155/339 - (45%) Gaps:75/339 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTLTRRRMKWE-------AILQQNTDLTQVDAKLKRYIRK----------------------GIP 72
            |...|.|.|::       |.||..:...:||.:||..|..                      |||
Zfish   177 KRKDRLRQKFQKNCDIVTACLQAVSQKRRVDTRLKFTIEPSLGKNGFQQWYDALKAVARLPVGIP 241

  Fly    73 GPYRPDVWMKISGAAAAQRRSPDLFRNLL--------------RTEPFDKEISDSISIDLPRTFP 123
            ..:|..||:.::          |.:.:.:              |:.|.|..:...|..||.||..
Zfish   242 KEWRKRVWLTLA----------DQYLHSISIDWEKTMRFAFNDRSNPDDDSLGIQIVKDLHRTGC 296

  Fly   124 DNI---HFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTD-DEEKSFWLLKHIVENIV 184
            .:.   ..:..:..|..:|:|||..|:.||||||.|.:|.|:|.||: :|..:..::.::::.::
Zfish   297 SSYCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNVLAALILEVTEGNEGDALKVMIYLIDKVL 361

  Fly   185 P-QYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNL--------GLPYP-----VIASKWFICI 235
            | .|.::|:..|..|:||||:|:..::|.:::|:.:|        |..|.     |...:||:.:
Zfish   362 PDSYFANNLRALSVDMAVFRDLLRLKLPELSQHLHHLQKVANREAGGSYEPPLTNVFTMQWFLTM 426

  Fly   236 FAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGC---DDIAALANLFRDTMIQDNI 297
            ||..||..|||:|||.||.||.:::.|.||.::......|..|   |:..::.......|::..:
Zfish   427 FATCLPHHTVLKIWDSVFFEGSEMLLRVALAIWAKLGERIEECQTADEFYSIMGCLTQEMLEHKL 491

  Fly   298 VTDCHGFVEAMFSL 311
            : |.:..::.::|:
Zfish   492 I-DSNELMQTVYSM 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 70/262 (27%)
tbc1d30XP_021331078.1 TBC 239..458 CDD:214540 69/228 (30%)
DUF4682 625..775 CDD:318030
HrpB7 733..>820 CDD:330448
Herpes_BLLF1 <825..>973 CDD:330317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.