DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d12a

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_021330042.1 Gene:tbc1d12a / 563626 ZFINID:ZDB-GENE-030131-3920 Length:823 Species:Danio rerio


Alignment Length:278 Identity:66/278 - (23%)
Similarity:119/278 - (42%) Gaps:52/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WEAILQQNTDLTQVDAKLKRYIR----KGIPGPYRPDVWMKISGAAAAQRRSPDLF--------- 97
            ||::  :||          |.:|    :|:|...|..||....|...  ..:|:|:         
Zfish   506 WESM--RNT----------RRVRDLWWQGVPPSVRGKVWCLAIGNEL--NITPELYEIFLSRAKE 556

  Fly    98 --RNLLRTEPF-----------DKEIS-DSISIDLPRTFPDNIHFDMK----KQRLYNILIAYAH 144
              |:...|...           |:|.| |.|.:|:.|||| :::...|    ...|:::|.||..
Zfish   557 KWRSFSETSSVNENEDCGVSLADRESSLDLIKLDISRTFP-SLYIFQKGGPYHDILHSVLGAYTC 620

  Fly   145 HNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYH---SHNMANLLRDLAVFRELV 206
            :..||||.||:::||. :||:..:|..:|....:::........   .|::  :|:..|.|....
Zfish   621 YRPDVGYVQGMSFIAA-VLILNLEEADAFIAFANLLNKPCQMAFFRVDHDL--MLKYFAAFEVFF 682

  Fly   207 IRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTH 271
            ...:|.:.:|..|..|........|...::::.||::...|:||....:|.:.:||..|.:...:
Zfish   683 EENLPRLFQHFQNNSLTPDFYLIDWIFTLYSKSLPLDVACRVWDVFCRDGEEALFRTGLGILRLY 747

  Fly   272 KNAILGCDDIAALANLFR 289
            ::.:|..|.|.:...|.|
Zfish   748 QDVLLQMDFIHSAQFLSR 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 56/242 (23%)
tbc1d12aXP_021330042.1 TBC 519..752 CDD:214540 55/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.