DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d10ab

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_691101.1 Gene:tbc1d10ab / 562628 ZFINID:ZDB-GENE-081105-145 Length:479 Species:Danio rerio


Alignment Length:332 Identity:97/332 - (29%)
Similarity:148/332 - (44%) Gaps:55/332 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASSKFSD------------VDEYGF------KRGDHFDYNNYSKFMDGYLKTLTRRRMKWEAILQ 51
            :||:.||            .|:|||      ..|::.|        |.....|.:|..||..:| 
Zfish    30 SSSRGSDSELNGFANTEVQPDKYGFIGGAQQTAGENSD--------DIPPDVLRQREAKWLDML- 85

  Fly    52 QNTD--LTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSI 114
            .|.|  :.:...|:|...:||||...|...|:.:||....:.::|..|:. |.::|.|.:..|.|
Zfish    86 NNWDKWMAKKHKKVKLRCQKGIPPSLRGRAWLYLSGGKVKKEQNPGKFKE-LDSQPGDPKWLDVI 149

  Fly   115 SIDLPRTFPDNIHFDMK----KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWL 175
            ..||.|.||.:..|..:    :|.|:.:|.||..|..:.||||....||.:||:....|: :||.
Zfish   150 EKDLHRQFPFHEMFVARGGHGQQDLFRVLKAYTLHRPEEGYCQAQAPIAAVLLMHMPAED-AFWG 213

  Fly   176 LKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVL 240
            |..|.|..:|.|:|..:..:..|..:...|:.|..|..:||:....:...:..::||:|.|:..|
Zfish   214 LVQICEKYLPGYYSAGLEAIQLDGEILFALLKRVSPVAHRHLKKYKIDPILYMTEWFMCAFSRTL 278

  Fly   241 PVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFV 305
            |..:|||:||..|.||.||:||..|.:.    ..:||..:                .:..|.|..
Zfish   279 PWASVLRVWDMFFCEGVKIIFRVGLVLL----KCMLGSPE----------------KLKACQGQY 323

  Fly   306 EAMFSLR 312
            |.|..||
Zfish   324 ETMELLR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 69/212 (33%)
tbc1d10abXP_691101.1 TBC 105..307 CDD:214540 69/207 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.