DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d2

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_689604.6 Gene:tbc1d2 / 561110 ZFINID:ZDB-GENE-140106-100 Length:926 Species:Danio rerio


Alignment Length:374 Identity:107/374 - (28%)
Similarity:170/374 - (45%) Gaps:66/374 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DATASSKFSDVDEYGFKRGDHFDYNNYSKFMDGYLKTLTR---RRMKWEAILQQNT--------- 54
            :|...:..||.|||||:..  .||    |..|  ||.|.:   ...:.:.:|.|..         
Zfish   542 NAIKLNPISDYDEYGFRIA--VDY----KVED--LKLLAKIQALEFRSQNLLNQEECDGPLLARC 598

  Fly    55 ----------DLTQVDAKLKRYIRKGIPGPYRPDVW--MKISGAAAAQRRSPDLFRNLL---RTE 104
                      :||. .|::|..:|.|:|..||..||  |..:...:.:.|.||.:..|.   |:.
Zfish   599 AQLLFGRPEGELTS-SAEMKGLLRTGLPHEYRVRVWRFMIQTRTKSLRERHPDRYHELCEKSRSS 662

  Fly   105 PFDKEISDSISIDLPRTFPDNIHFDMKK----QRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIV 165
            |  ..:...|.:||.||...|.||....    |:|..:|.|::.||..:||.||||.:|.:.|:|
Zfish   663 P--HLVPRQIQLDLDRTLTSNKHFSPPTSPLIQKLERVLQAFSWHNPTIGYVQGLNRLAAIALLV 725

  Fly   166 TDDEEKSFWLLKHIVENIV-PQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIAS 229
            ..:|..:||.|..|||:|: |.|.:.::.....|..|.::|::.::|.:..|::.|.:...:|..
Zfish   726 LQEEADAFWCLVVIVEHIMPPNYFTKDLVGCQADQRVLKDLMLEKLPRLTAHLEALKVDISLITV 790

  Fly   230 KWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQ 294
            :||:.:|.|.||...:.::||.:..||.|::||.||.:|...:.|||...|...:....|   |.
Zfish   791 EWFLVLFVESLPTRILFKVWDALLYEGSKVIFRYALALFKYREEAILKIQDSVEMYQYLR---IF 852

  Fly   295 DNIVTDCHGFVEAMFS----LRLKR----------------SELESLRK 323
            .|.:.|........|:    ||::.                .|||:|:|
Zfish   853 PNTIADGRKLTSIAFNDMNPLRMRLIQNRRAAHLERLHAEIKELENLQK 901

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 71/218 (33%)
tbc1d2XP_689604.6 PH 56..146 CDD:278594
PH_TBC1D2A 57..153 CDD:269966
TBC 621..837 CDD:214540 71/217 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100958
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.