DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and si:ch211-266k8.4

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_687788.5 Gene:si:ch211-266k8.4 / 559362 ZFINID:ZDB-GENE-131121-469 Length:617 Species:Danio rerio


Alignment Length:376 Identity:97/376 - (25%)
Similarity:164/376 - (43%) Gaps:80/376 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEYGF---KRGDH------FDYNNYSKFMDGYLKTLTRRRMKWEAILQQNTDLTQVDAKLKRYIR 68
            ||:||   |:.|.      .|| :|.:.....:|.|......|      |.......::::|:||
Zfish    28 DEFGFAFSKKRDKKLQQRCHDY-SYPQPNPVKVKELCEFLSYW------NGSSFICRSQIERFIR 85

  Fly    69 KGIPGPYRPDVW---MKISGAAA----------AQRRSP--DL----------FRNLLRTEPFDK 108
            .|||...|..||   :.|....|          ::.|.|  ||          ..:|:.||   .
Zfish    86 IGIPPAIRGRVWRCLLNIDSLRATSCFNYEDCQSEIRRPLVDLGVSEYSIISSIDSLVDTE---N 147

  Fly   109 EISD---------------SISIDLPRTFP-------DNIHFDMKKQRLYNILIAYAHHNRDVGY 151
            |||.               .|::||.|:||       |.......:.:|:.:|.|:|.:|..:||
Zfish   148 EISSGQASSPQVADLTLFKQIALDLQRSFPTHRTLMGDRPEAIEGQAKLFRVLSAFARYNPLIGY 212

  Fly   152 CQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSH----NMANLLRDLAVFRELVIRRIPA 212
            .||::|||.:||::..:|| :||.|..::|.  |:|.|.    :|..:.....||.:|:..|.|.
Zfish   213 VQGMSYIAAVLLMILSEEE-AFWALVALLEK--PKYLSELFDSSMKKIQHQALVFHQLLKHRKPL 274

  Fly   213 VNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILG 277
            :.:|::.||:.......:||:.:|..:...::||.|||.:...|.:.|||..||:.:..::.|:.
Zfish   275 LFQHLETLGVSCVHFIMQWFLTLFTSLPCWDSVLAIWDLIMLHGLQAVFRTGLTIILLLESRIMN 339

  Fly   278 CDDIAALANLFRDTMIQDNIVTDCHG--FVEAMFSLRLKRSELESLRKVAV 326
            ..:.|.:..|.....|.     .||.  .:.|::|..|:..|:..:..:.:
Zfish   340 MTEEATVLPLLLRVPID-----ICHHRVLIPALWSTDLQEWEINCMNSLVL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 73/259 (28%)
si:ch211-266k8.4XP_687788.5 RabGAP-TBC 166..338 CDD:278964 53/174 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.