DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d14

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005166496.1 Gene:tbc1d14 / 557744 ZFINID:ZDB-GENE-030131-6136 Length:711 Species:Danio rerio


Alignment Length:248 Identity:56/248 - (22%)
Similarity:100/248 - (40%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KGIPGPYRPDVWMKISG---------------------------AAAAQRRSPDLFRNLLRTEPF 106
            :|:|...|..||....|                           .||.:..|.|     ......
Zfish   419 QGLPPSVRGKVWSLAIGNELNITDELYDICLARAKEKWNAFVAPTAAVETESED-----AGLSHA 478

  Fly   107 DKEIS-DSISIDLPRTFPDNIHF-------DMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLL 163
            |:|.| :.|.:|:.||||:...|       |:    |::||.||..:..||||.||:::||.:|:
Zfish   479 DREASLELIKLDISRTFPNLCIFQKGGPYHDV----LHSILGAYTCYRPDVGYVQGMSFIAAVLI 539

  Fly   164 IVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIA 228
            :..|..:........:.:.....::..:.:.:|...|.|.......:|.:..|..|..|...:..
Zfish   540 LNLDTADAFIAFANLLNKPCQMAFYRVDHSLMLTYFAAFEVFFEENLPKLFAHFKNNNLSSDIYL 604

  Fly   229 SKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDI 281
            ..|...::::.||::...|:||....:|.:.:||.||.:...:::.:...|.|
Zfish   605 IDWIFTLYSKSLPLDIACRVWDVFCRDGEEFLFRTALGILRLYEDILTHMDFI 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 54/241 (22%)
tbc1d14XP_005166496.1 COG5210 293..656 CDD:227535 54/245 (22%)
RabGAP-TBC 485..651 CDD:278964 41/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.