DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and si:dkeyp-19e1.3

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005170766.1 Gene:si:dkeyp-19e1.3 / 553000 ZFINID:ZDB-GENE-081104-56 Length:736 Species:Danio rerio


Alignment Length:341 Identity:82/341 - (24%)
Similarity:152/341 - (44%) Gaps:62/341 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASSKFSDVDEY--GFKRGDHF------DYNNYSKFMDGY-------LKTLT-----------RRR 43
            |..:...:::|  |.:.|.|.      ||:.: ||.|.:       |.|.|           .|.
Zfish    10 AEERADIIEKYEKGRQEGVHINPWEDGDYSIF-KFTDRFGFLHEEELPTPTAVEEKYKLQEMERE 73

  Fly    44 MKWEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDVW---MKISGAAAAQRRSPDLFRNLLRTEP 105
            .||..::::.......:..:|| :.||||...|...|   :.:.....|..|..:..:.  :.:.
Zfish    74 EKWIKMVKKWEKYHNSEKMMKR-VYKGIPLKLRGQAWALLLDVEKVKQANFRKYEKMKE--QAKR 135

  Fly   106 FDKEISDSISIDLPRTFPDNI----HFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVT 166
            :..||. .|.:|:.|||.::|    .|.:|:|.|:::|.||:.:|.:|.||||::.||.:||:..
Zfish   136 YSTEIK-QIDLDVNRTFRNHIMFMERFGVKQQALFHVLAAYSVYNTEVSYCQGMSQIAAILLMYM 199

  Fly   167 DDEEKSFWLLKHIVEN--------IVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLP 223
             :||.:||.|..::.|        .:|.:...:...:..|     :::.:.:..:..|::...:.
Zfish   200 -NEEDAFWALSQLLTNQKHAMHGFFIPGFPKLHRFQVHHD-----KILSKLLSKLRNHLEKEQMS 258

  Fly   224 YPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAI--LGCDDI----- 281
            ..:..:|||:..|.:..|....||:||....||.|::...|.|:...||..:  |..:|:     
Zfish   259 TGIYTTKWFLQCFIDRTPFTLTLRLWDIYILEGEKVLTAMAYTLLKLHKKHLLKLSLEDLREFLQ 323

  Fly   282 ---AALANLFRDTMIQ 294
               |:..|:..|.:|:
Zfish   324 ERTASSFNMSDDVVIE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 58/225 (26%)
si:dkeyp-19e1.3XP_005170766.1 TBC 96..301 CDD:214540 55/213 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.