DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D13

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_060671.3 Gene:TBC1D13 / 54662 HGNCID:25571 Length:400 Species:Homo sapiens


Alignment Length:323 Identity:59/323 - (18%)
Similarity:110/323 - (34%) Gaps:113/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KWEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDL-----------FR 98
            :|....:.|..|.|:|..::|..         ||:        :..:|:.|.           |.
Human   109 RWNTYFKDNEVLLQIDKDVRRLC---------PDI--------SFFQRATDYPCLLILDPQNEFE 156

  Fly    99 NL--------LRTEPFDKEISDSISIDLP--RTFPDNI------------HFDMKKQRLYNILIA 141
            .|        |:::...:..|...::..|  .:.|.::            |:::.::    ||..
Human   157 TLRKRVEQTTLKSQTVARNRSGVTNMSSPHKNSVPSSLNEYEVLPNGCEAHWEVVER----ILFI 217

  Fly   142 YAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFW--------------LLKHIVENIVPQ------ 186
            ||..|..:.|.||:|.|.|.|......:..|.|              |:..|.:|.:..      
Human   218 YAKLNPGIAYVQGMNEIVGPLYYTFATDPNSEWKEHAEADTFFCFTNLMAEIRDNFIKSLDDSQC 282

  Fly   187 ---YHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRI 248
               |....:.:.|:|..|  ||.::        :....:.....|.:|...:.::...:..|:||
Human   283 GITYKMEKVYSTLKDKDV--ELYLK--------LQEQNIKPQFFAFRWLTLLLSQEFLLPDVIRI 337

  Fly   249 WDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRD-----------TMIQDNIVTD 300
            ||.:||:..:..|            .:|.|   .|:..|.|:           .::||..:||
Human   338 WDSLFADDNRFDF------------LLLVC---CAMLMLIREQLLEGDFTVNMRLLQDYPITD 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 44/264 (17%)
TBC1D13NP_060671.3 TBC 32..367 CDD:214540 55/303 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.