DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d8

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_017177250.1 Gene:Tbc1d8 / 54610 MGIID:1927225 Length:1160 Species:Mus musculus


Alignment Length:235 Identity:72/235 - (30%)
Similarity:121/235 - (51%) Gaps:12/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDK--EISDSISIDLPRTFPD 124
            |:::.:..|||...|..:|:..|.|.......|..:.||:. :...:  .:::.|..||.|:.|:
Mouse   511 KIRKLVAMGIPESLRGRLWLLFSDAVTDLASHPGYYGNLVE-QSLGRCCLVTEEIERDLHRSLPE 574

  Fly   125 NIHFDMKK--QRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQY 187
            :..|..:.  ..|..:|.||||.|..:||||.:|.:..:||:...:|| :||||..:.|.::|.|
Mouse   575 HPAFQNETGIAALRRVLTAYAHRNPKIGYCQSMNILTSVLLLYAKEEE-AFWLLVAVCERMLPDY 638

  Fly   188 HSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCV 252
            .:|.:.....|.:||.||:..::|.:..|:.:|. ....|:..||:.:|..::|:|:.:.:.||.
Mouse   639 FNHRVIGAQVDQSVFEELIKEQLPELAEHMSDLS-ALASISLSWFLTLFLSIMPLESAVHVVDCF 702

  Fly   253 FAEGYKIVFRAALTMFVTHKNAILGC---DDIAALANLFR 289
            |.:|.|.:|:..|.  |...||...|   ||..||..|.|
Mouse   703 FYDGIKAIFQLGLA--VLEANAEELCSSKDDGQALMVLSR 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 64/212 (30%)
Tbc1d8XP_017177250.1 PH-GRAM1_TBC1D8 171..269 CDD:270156
PH-GRAM2_TBC1D8 311..406 CDD:270160
TBC 519..725 CDD:214540 64/210 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.