DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d5

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_008764990.1 Gene:Tbc1d5 / 501088 RGDID:1561626 Length:827 Species:Rattus norvegicus


Alignment Length:406 Identity:84/406 - (20%)
Similarity:150/406 - (36%) Gaps:128/406 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DATASSKFSDVDEYGFKRGDHFDYNNY-----SKFMDGYLKTLTRRRMKWE---AILQQNTDLTQ 58
            |.|.||...:.|       |.|..|||     .|.::|.|::...|.:.|:   .:|.|  |.:|
  Rat    49 DGTFSSYMREWD-------DLFVNNNYLAAVRQKGINGQLRSSRFRSICWKLFLCVLPQ--DKSQ 104

  Fly    59 VDAKLKRY------IRK-GIPGPYRPDVWMKISGAAAAQRRSP------DLFRNLLRTEPFDKEI 110
            ..:::|..      |:: .|..|      .|:.|.......:|      .|:....:    |||:
  Rat   105 WISRIKELRSWYSNIKEIHITNP------RKVVGQQDLMINNPLSQDEGSLWNKFFQ----DKEL 159

  Fly   111 SDSISIDLPRTFPDNIHFDMKKQR--LYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSF 173
            ...|..|:.||||:...|..:..|  |.::|..||..|..:.|.||::.:...::.....:.::|
  Rat   160 RSMIEQDVRRTFPEMQFFQQENVRKILTDVLFCYARENEQLLYKQGMHELLAPIIFTLHCDHQAF 224

  Fly   174 WLLKHIVEN----------IVPQYHSHNMANLLRDL--------AVF-------RELVIRRIP-- 211
               .|..|:          :.|:|..|:...:...|        :.|       :|.::..||  
  Rat   225 ---LHASESAQPSEEMKTLLNPEYLEHDAYAMFSQLMETAEPWFSTFEHDGQKGKETLMPPIPFA 286

  Fly   212 -------------AVNR---------------HVDNLGLPYPVIASKWFICIFAEVLPVETVLRI 248
                         .||:               |::.|.:|..:...:|...:|....|::.:|.:
  Rat   287 RPQDLGPTVAIVTKVNQIQDHLLKKHDTELYMHLNRLEIPPQIYGLRWVRLLFGREFPLQDLLVV 351

  Fly   249 WDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDN------------IVTDC 301
            ||.:||:|..:    :|..:|           ..|:....||.:|..|            ::.|.
  Rat   352 WDALFADGLHL----SLVDYV-----------FTAMLLYIRDALISSNYQTCLGLLMHYPLIGDI 401

  Fly   302 HGFV-EAMFSLRLKRS 316
            |..: :|:|....||:
  Rat   402 HSLILKALFLRDPKRN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 53/272 (19%)
Tbc1d5XP_008764990.1 TBC 79..381 CDD:214540 65/331 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.