DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D25

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001335191.1 Gene:TBC1D25 / 4943 HGNCID:8092 Length:704 Species:Homo sapiens


Alignment Length:234 Identity:46/234 - (19%)
Similarity:86/234 - (36%) Gaps:56/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RRMKWEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISG-------AAAAQRRSPD---- 95
            |::.|..:|....|              |:.|..|.| :||...       :..|||.:|:    
Human   250 RKVVWRYLLNVYPD--------------GLTGRERMD-YMKRKSREYEQLKSEWAQRANPEDLEF 299

  Fly    96 ----LFRNLLRTEPFDKEISDSISIDLPRTFP------DNIHFDMKKQRLYNILIAYAHHNRDVG 150
                :.:::|||:               |..|      |..|.    :.|:::|..||..:..|.
Human   300 IRSTVLKDVLRTD---------------RAHPYYAGPEDGPHL----RALHDLLTTYAVTHPQVS 345

  Fly   151 YCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNR 215
            ||||::.:|..:|.|.|.|..:|.....|::.:...:|....| :....|..:.|:....|...:
Human   346 YCQGMSDLASPILAVMDHEGHAFVCFCGIMKRLAANFHPDGRA-MATKFAHLKLLLRHADPDFYQ 409

  Fly   216 HVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFA 254
            ::...|........:|.:.........:..||:.:..::
Human   410 YLQEAGADDLFFCYRWLLLELKREFAFDDALRMLEVTWS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 42/209 (20%)
TBC1D25NP_001335191.1 TBC 241..470 CDD:214540 46/234 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.