DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d15

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005159143.1 Gene:tbc1d15 / 492676 ZFINID:ZDB-GENE-041111-251 Length:665 Species:Danio rerio


Alignment Length:241 Identity:54/241 - (22%)
Similarity:95/241 - (39%) Gaps:61/241 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KFMDGYLKTLTRRRMKWEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSP 94
            ||:.||        ..|.:..::...|.:  .|...|.|..:.       |..:|  ...:||:.
Zfish   336 KFLLGY--------FPWSSTHEERKLLQK--RKTDEYFRMKLQ-------WKSVS--EEQERRNS 381

  Fly    95 DL--FRNLLRTEPFDKEISDSISIDLPRTFPDNIHFDMKKQ----RLYNILIAYAHHNRDVGYCQ 153
            .|  :|:|             |..|:.||..:|..::....    .|::||:.|..::.|:||.|
Zfish   382 RLRDYRSL-------------IEKDVNRTDRNNKFYEGLDNPGLILLHDILMTYCMYDFDLGYVQ 433

  Fly   154 GLNYIAGLLLIVTDDEEKSFW----LLKHIVENIVPQYHSH-----NMANLLR--DLAVFRELVI 207
            |::.:...:|.|.::|..:||    .:..:.||...|....     .::.|||  |||.:..|  
Zfish   434 GMSDLLSPILFVMENEVDAFWCFVSFMDEMHENFEEQMQGMKTQLIQLSTLLRLLDLAFWNYL-- 496

  Fly   208 RRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVF 253
                    ...:.|  |.....:|.:..|...|..:.|||:|:.::
Zfish   497 --------EAQDSG--YLYFCFRWLLIRFKRELHFQDVLRLWEVMW 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 46/204 (23%)
tbc1d15XP_005159143.1 DUF3548 4..220 CDD:192931
TBC 322..557 CDD:214540 54/241 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.