DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and grtp1

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001005632.1 Gene:grtp1 / 448089 XenbaseID:XB-GENE-950226 Length:342 Species:Xenopus tropicalis


Alignment Length:327 Identity:133/327 - (40%)
Similarity:204/327 - (62%) Gaps:9/327 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TASSKFSDVDEYGFKRGDHFDYNNYSKFMDGYLKTLTRRRMKWEAILQQNTDLTQVDAKLKRYIR 68
            ||......:|.|||.|...|||..|.:|:..|...||||.:||..:|||:. ..:.:.|:|||||
 Frog     7 TAQDSVPRIDGYGFVRPAEFDYAFYEEFIARYHVVLTRRAIKWSKLLQQSA-AVEKNMKVKRYIR 70

  Fly    69 KGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFPDNIHFDMK-- 131
            ||||..:|..|||.:|||.|....:...||.:......:.::.|.:..||.||||||:.|...  
 Frog    71 KGIPNEHRSHVWMVVSGAQAQMDMNTGYFRRMFTEGEKNPKLLDLVITDLNRTFPDNVLFQKNAN 135

  Fly   132 ---KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMA 193
               ::.|||:|:||..||:.||||||:|:|||.|::||.||||:|||:..::..|:|.|:|..|.
 Frog   136 PSLQKDLYNVLVAYGQHNKTVGYCQGMNFIAGYLILVTKDEEKAFWLMDALIGQILPDYYSPAMT 200

  Fly   194 NLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYK 258
            .|..|..|..:||.::||:|.:.::..|:.:.::.|:||||:|.::||||||||||||:|.||.|
 Frog   201 GLKTDQEVLGDLVKKKIPSVAQLIETHGVMWTLLVSRWFICLFIDILPVETVLRIWDCLFFEGSK 265

  Fly   259 IVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSL--RLKRSELESL 321
            ::||.|||:....:.:|:...:...:.:.|:: :.:...|||||.|::.:|:.  .|.::.::.|
 Frog   266 VIFRVALTLIKQSQASIMEARNFPDICDKFKE-ITKGEFVTDCHYFMQKIFAEPGSLSKTTIDKL 329

  Fly   322 RK 323
            |:
 Frog   330 RE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 95/213 (45%)
grtp1NP_001005632.1 TBC 69..283 CDD:214540 95/213 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 193 1.000 Domainoid score I3147
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H84592
Inparanoid 1 1.050 265 1.000 Inparanoid score I2976
OMA 1 1.010 - - QHG53652
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 1 1.000 - - FOG0003486
OrthoInspector 1 1.000 - - oto103740
Panther 1 1.100 - - LDO PTHR22957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 1 1.000 - - X2377
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.