DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D3C

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006721967.1 Gene:TBC1D3C / 414060 HGNCID:24889 Length:610 Species:Homo sapiens


Alignment Length:327 Identity:81/327 - (24%)
Similarity:134/327 - (40%) Gaps:50/327 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DATASSKFSDVDEYGFKRGDHFDYNNYSKFMDGYLK--TLTRRRMKWEAILQQNTDLTQVDAKLK 64
            :.:..||:.|:      .||...|.:..|.:|...|  .:..|...|..:|  ||:    :.|||
Human   132 EISRKSKWVDM------LGDWEKYKSSRKLIDRAYKGMPMNIRGPMWSVLL--NTE----EMKLK 184

  Fly    65 RYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFPDNIHFD 129
            .      ||.|:   .||..|     :||.:..:.:      |:::|.::...:  .|.|  .:.
Human   185 N------PGRYQ---IMKEKG-----KRSSEHIQRI------DRDVSGTLRKHI--FFRD--RYG 225

  Fly   130 MKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIV---ENIVPQYHSHN 191
            .|::.|.:||:||..:|.:||||:.|::||.|.|:.. .||.:||.|..::   .:.:..:||.|
Human   226 TKQRELLHILLAYEEYNPEVGYCRDLSHIAALFLLYL-PEEDAFWALVQLLASERHSLQGFHSPN 289

  Fly   192 MANL--LRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFA 254
            ...:  |:|..  ..:|....|....|.|...|..........|.|..:.:.:...||:||....
Human   290 GGTVQGLQDQQ--EHVVATSQPKTMGHQDKKDLCGQCSPLGCLIRILIDGISLGLTLRLWDVYLV 352

  Fly   255 EGYKIVFRAALTMFVTHKNAIL---GCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSLRLKRS 316
            ||.:.:.......|...:..:.   .|...|...|.|.||..:|......| ...:|..|..|:.
Human   353 EGEQALMPITRIAFKVQQKRLTKTSRCGPWARFCNRFVDTWARDEDTVLKH-LRASMKKLTRKKG 416

  Fly   317 EL 318
            :|
Human   417 DL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 52/213 (24%)
TBC1D3CXP_006721967.1 TBC 160..373 CDD:214540 61/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.