DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and wkd

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster


Alignment Length:322 Identity:84/322 - (26%)
Similarity:151/322 - (46%) Gaps:38/322 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FMDGYLKT-----------LTRRRMKWEAILQQ-NTDLTQVDAKLKRYIRKGIPGPYRPDVWMKI 83
            |..|:.:|           :..|..||..::.. :..:::...|::...|||||...||..|..:
  Fly    26 FYGGFQRTDKPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYL 90

  Fly    84 SGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFP-DNIHFDMKKQ---RLYNILIAYAH 144
            |||...::::|:::..||. :|.:....:.|..|..|.|| ..:..|.:|.   .|:|:|.||:.
  Fly    91 SGAYLLKKKNPNVYNELLE-KPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSI 154

  Fly   145 HNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRR 209
            :|..||:||....||..||:....|: :||:...:.:..:..|....:..:..|..:...|:.:.
  Fly   155 YNPKVGFCQAQAPIAAFLLMHLPAED-AFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEGLLKKT 218

  Fly   210 IPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTM----FVT 270
            .|.|.||:....:...:..:.||:|.....||.||:||:|||..|||.:::|:.||.:    ...
  Fly   219 CPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSR 283

  Fly   271 HK--NAILG-CDDIAAL----ANLFRDTMIQDNIVTDCHGFVEAMFSLRLKRSELESLRKVA 325
            ||  ....| |:.:|.|    .::..:..|.:|::         ..:||::..::|..|:.|
  Fly   284 HKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMM---------RLNLRVEDFQIEHTRQKA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 66/218 (30%)
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 49/163 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456627
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D74517at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.