DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and CG42795

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001287272.1 Gene:CG42795 / 41252 FlyBaseID:FBgn0261928 Length:3213 Species:Drosophila melanogaster


Alignment Length:288 Identity:83/288 - (28%)
Similarity:140/288 - (48%) Gaps:34/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KLKRYIRKGIPGPYRPDVW-------MKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLP 119
            ||...:..|.|..:|..:|       :|......||:|. ..|....|.:  |:|:...|..||.
  Fly   213 KLVARLPGGTPPEFRRKLWLSLADKYLKSKNVDWAQQRE-KCFCEEWRED--DEELGIQIVKDLH 274

  Fly   120 RTFPDNI----HFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTD-DEEKSFWLLKHI 179
            || ..|:    ...:.:.:|..||:.||.:|.:||||||.|.:..|:|.|.| :||:|..::.::
  Fly   275 RT-GSNLCTGPAGSINQAKLKRILLGYARYNPEVGYCQGFNMLGALILQVMDKEEEESMKVMIYL 338

  Fly   180 VENIVPQ-YHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYP---------VIASKWFIC 234
            ||.::|. |...:|..|..|:.|||||:..|:|.:.:|:..|..|..         |...:||:.
  Fly   339 VEGVLPTGYFYGSMGGLQADMGVFRELMQTRLPRLAKHLQRLQGPVENAFEPPLTNVFTMQWFLT 403

  Fly   235 IFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAIL---GCDDIAALANLFRDTMIQDN 296
            :|...||:..|||:||.|..||..::.|.||.::...:..::   ..|:.......:...::..:
  Fly   404 MFCTCLPMSCVLRVWDLVLIEGSDVLLRTALVLWSLLEERVISVRSADEFYGKMGSYSSELLNGH 468

  Fly   297 IVTDCHGFVEAMFSLRLKRSELESLRKV 324
            :| |.:|.:|.:    :|...:|.||::
  Fly   469 LV-DSNGLIERV----VKLGPIEDLRQL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 72/230 (31%)
CG42795NP_001287272.1 RabGAP-TBC 268..443 CDD:278964 60/175 (34%)
DUF4682 560..684 CDD:292361
DBP 1112..1415 CDD:289157
SWIRM-assoc_2 <2376..2482 CDD:293105
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456598
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.